Skip to main content

Advertisement

Table 2 Potential Consensus PDZ Domain Binding Sequences in SR-BI, SR-BII and CD36

From: Cellular cholesterol delivery, intracellular processing and utilization for biosynthesis of steroid hormones

Mouse SR-BI: QLRSQEKCFLFWSGSKKGSQDKEAIQAYSESLMSPAAKGTVLQEAKL
  QLRSQEKCFLF WSGSKKGSQDKEAIQA YSESLMSP AAKGTVLQEAKL
Rat SR-BI: QLRSQEKCFLFW SGSKKGSQDKEAM QAYSWSLMSPAA KGTVL QEAKL
  QLRSQEKCFLF WSGSKKGSQDKEAMQA YSWSLMSP AAKGTVLQEAKL
Hamster SR-BI: QLRSQEKCFLFW SGSKKGSQDKEAI QAYAESL MSPAA KGTVL QEAKL
  QLRSQEKCFLF WSGSKKGSQDKEAIQA YAESLMSP AAKGTVLQEAKL
Rabbit SR-BI: QVRSQEKCYLFW SGSKKGSKDKEAI QAYSESL MTPDP KGTVL QEARL
  QVRSQEKCYLFWSGSKKGSKDKEAIQA YSESLMTP DPKGTVLQEARL
Pig SR-BI: QIRSQEKCYLFW SSSKKGSKDKEAI QAYSESL MTPAP KGTVL QEARL
  QIRSQEKCYLFWSSSKKGSKDKEAIQA YSESLMTP APKGTVLQEARL
Cow SR-BI: QIRSQEKCYLFW ISFKKGSKDKEAV QAYSEFL MTSPPKGTVL QEARL
  QIRSQEKCYLFWISF KKGSKDKEAVQA YSEFLMTSPPKGTVLQEARL
Human SR-BI: QIRSQEKCYLFW SSSKKGSKDKEAI QAYSESL MTSAPKGSVL QEAKL
  QIRSQEKCYLFWSSSKKGSKDKEAIQA YSESLMTSAPKGSVLQEAKL
Mouse SR-BII: QLRSQGPEDTI SPPNLIAWSDQPPSPYTPLLEDSLSGQPTSAMA
  QLRSQGPEDTISPPNLIAWSDQPPSPYTPLLEDSLSGQPTSAMA
Rat CD36: RSKNGK-None
  1. PDZ Domain-Class I: S or T-X-I, V, L or M; PDZ Domain-Class II: ψ-X-ψ; PDZ Domain-Class III: D or E -X-ψ. The C-terminal residue is referred to as Po residue; subsequent residues towards the N-terminus are termed P-1, P-2, P-3 etc. X denotes any amino acid (no specificity defined at this position for this class). ψ denotes a hydrophobic amino acid usually V, I or L. The sequences of C-terminal domain of SR-BI, SR-BII and CD36 are presented in duplicates to accomodate 3 letter overlapping combinations of putative PDZ binding sites. The putative PDZ domain binding sequences (three letters) are shown as bold letters.